XYLT1 Rabbit Polyclonal Antibody TA338489 from OriGene Technologies | Biocompare.com

Supplier Images

XYLT1 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
XYLT1 Rabbit Polyclonal Antibody

The XYLT1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to XYLT1. This antibody recognizes Human antigen. The XYLT1 Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-XYLT1 Antibody

Product Specs
ItemXYLT1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA338489
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetXYLT1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF
NCBI Full Gene Namexylosyltransferase 1
NCBI Gene AliasesXT-I, XT1, DBQD2, xylT-I, XYLTI, PXYLT1, XTI
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!